Pyruvate, Phosphate Dikinase, Recombinant, Clostridium symbiosum, aa384-511, His-Tag, Myc-Tag

Artikelnummer: USB-586109
Artikelname: Pyruvate, Phosphate Dikinase, Recombinant, Clostridium symbiosum, aa384-511, His-Tag, Myc-Tag
Artikelnummer: USB-586109
Hersteller Artikelnummer: 586109
Alternativnummer: USB-586109-20,USB-586109-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Catalyzes the reversible phosphorylation of pyruvate and phosphate. In E.histolytica and C.symbiosus, PPDK functions in the direction of ATP synthesis. Partial recombinant protein corresponding to aa384-511 from Clostridium symbiosum Pyruvate, phosphate dikinase, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Swiss/Uniprot: P22983 Molecular Weight: ~20.5kD Amino Acid Sequence: AALKAGEVIGSALPASPGAAAGKVYFTADEAKAAHEKGERVILVRLETSPEDIEGMHAAEGILTVRGGMTSHAAVVARGMGTCCVSGCGEIKINEEAKTFELGGHTFAEGDYISLDGSTGKIYKGDIE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 20.5
UniProt: P22983
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.