Ras GTPase-activating Protein SynGAP, Recombinant, Human, aa1161-1343, His-Tag

Artikelnummer: USB-586112
Artikelname: Ras GTPase-activating Protein SynGAP, Recombinant, Human, aa1161-1343, His-Tag
Artikelnummer: USB-586112
Hersteller Artikelnummer: 586112
Alternativnummer: USB-586112-20, USB-586112-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Major constituent of the PSD essential for postsynaptic signaling. Inhibitory regulator of the Ras-cAMP pathway. Member of the NMDAR signaling complex in excitatory synapses, it may play a role in NMDAR-dependent control of AMPAR potentiation, AMPAR membrane trafficking and synaptic plasticity. Regulates AMPAR-mediated miniature excitatory postsynaptic currents. Exhibits dual GTPase-activating specificity for Ras and Rap. May be involved in certain forms of brain injury, leading to long-term learning and memory deficits. Source: Recombinant protein corresponding to aa1161-1343 from human Ras GTPase-activating protein SynGAP, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~25.5kD Amino Acid Sequence: MPHLSADIESAHIEREEYKLKEYSKSMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDHPAMAEPLPEPKKRLLDAQERQLPPLGPTNPRVTLAPPWNGLAPPAPPPPPRLQITENGEFRNTADH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 25.5
UniProt: Q96PV0
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.