Recombinant Saccharomyces Cerevisiae Dolichyl-phosphate-mannose--protein mannosyltransferase 1, aa292-584, His-Tag

Artikelnummer: USB-586135
Artikelname: Recombinant Saccharomyces Cerevisiae Dolichyl-phosphate-mannose--protein mannosyltransferase 1, aa292-584, His-Tag
Artikelnummer: USB-586135
Hersteller Artikelnummer: 586135
Alternativnummer: USB-586135-20, USB-586135-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Protein O-mannosyltransferase involved in O-glycosylation which is essential for cell wall rigidity. Forms a heterodimeric complex with PMT2 and more rarely with PMT3 to transfer mannose from Dol-P-mannose to Ser or Thr residues on proteins. The PMT1-PMT2 complex participates in oxidative protein folding, ER-associated protein degradation (ERAD), as well as ER export. Required for incorporation of proteins in the cell wall. Source: Recombinant protein corresponding to aa292-584 from Saccharomyces cerevisiae Dolichyl-phosphate-mannose--protein mannosyltransferase 1, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~39.4kD Amino Acid Sequence: HFQSLTLDGDGASFFSPEFRSTLKNNKIPQNVVADVGIGSIISLRHLSTMGGYLHSHSHNYPAGSEQQQSTLYPHMDANNDWLLELYNAPGESLTTFQNLTDGTKVRLFHTVTRCRLHSHDHKPPVSESSDWQKEVSCYGYSGFDGDANDDWVVEIDKKNSAPGVAQERVIALDTKFRLRHAMTGCYLFSHEVKLPAWGFEQQEVTCASSGRHDLTLWYVENNSNPLLPEDTKRISYKPASFISKFIESHKKMWHINKNLVEPHVYESQPTSWPFLLRGISYWGENNRNVYLL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 39.4
UniProt: P33775
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.