Replicase Polyprotein 1ab, Recombinant, Avian Infectious Bronchitis Virus, aa1-219, His-Tag

Artikelnummer: USB-586145
Artikelname: Replicase Polyprotein 1ab, Recombinant, Avian Infectious Bronchitis Virus, aa1-219, His-Tag
Artikelnummer: USB-586145
Hersteller Artikelnummer: 586145
Alternativnummer: USB-586145-20
Hersteller: US Biological
Kategorie: Molekularbiologie
The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products., NendoU is a Mn(2+)-dependent, uridylate-specific enzyme, which leaves 2-3-cyclic phosphates 5 to the cleaved bond. Source: Recombinant protein corresponding to aa1-219 from Avian infectious bronchitis virus Replicase polyprotein 1ab, fused to 6X His-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~30.1kD Amino Acid Sequence: GGGGQSFLAADNAVLVSTQCYKRHSYVEIPSNLLVQNGMSLKDGANLYVYKRVNGAFVTLPNTLNTQGRSYETFEPRSDVERDFLDMSEEDFVEKYGKDLGLQHILYGEVDKPQLGGLHTVIGMYRLLRANKLNAKSVTNSDSDVMQNYFVLADNGSYKQVCTVVDLLLDDFLELLRNILNEYGTNKSKVVTVSIDYHSINFMTWFEDGSIKTCYPQLQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 30.1
UniProt: P12723
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.