Ribonuclease 4, Recombinant, Human, aa29-147, His-Tag, Myc-Tag

Produktübersicht

• Artikelname: Ribonuclease 4, Recombinant, Human, aa29-147, His-Tag, Myc-Tag
• Artikelnummer: USB-586175
• Hersteller Artikelnummer: 586175
• Alternativnummer: USB-586175-20,USB-586175-100,USB-586175-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

This RNase has marked specificity towards the 3 side of uridine nucleotides. Source: Recombinant protein corresponding to aa29-147 from human Ribonuclease 4, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~20.8kD Amino Acid Sequence: QDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 20.8
• UniProt: P34096
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.