Ribosome-inactivating Protein Alpha-trichosanthin, Recombinant, Trichosanthes kirilowii, aa24-270, His-Tag

Produktübersicht

• Artikelname: Ribosome-inactivating Protein Alpha-trichosanthin, Recombinant, Trichosanthes kirilowii, aa24-270, His-Tag
• Artikelnummer: USB-586187
• Hersteller Artikelnummer: 586187
• Alternativnummer: USB-586187-20,USB-586187-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Inactivates eukaryotic 60S ribosomal subunits. Source: Recombinant protein corresponding to aa24-270 from Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~33.1kD Amino Acid Sequence: DVSFRLSGATSSSYGVFISNLRKALPNERKLYDIPLLRSSLPGSQRYALIHLTNYADETISVAIDVTNVYIMGYRAGDTSYFFNEASATEAAKYVFKDAMRKVTLPYSGNYERLQTAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFESPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 33.1
• UniProt: P09989
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.