Scrapie-responsive Protein 1, Recombinant, Mouse, aa21-98, His-Tag

Artikelnummer: USB-586248
Artikelname: Scrapie-responsive Protein 1, Recombinant, Mouse, aa21-98, His-Tag
Artikelnummer: USB-586248
Hersteller Artikelnummer: 586248
Alternativnummer: USB-586248-20, USB-586248-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa21-98 from mouse Scrapie-responsive protein 1, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~15.0kD Amino Acid Sequence: MPSSRLSCYRKLLKDRNCHNLPEGRADLKLIDANVQHHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 15
UniProt: O88745
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.