Secreted Protein BARF1, Recombinant, Epstein-Barr Virus, aa21-221, His-Tag

Artikelnummer: USB-586253
Artikelname: Secreted Protein BARF1, Recombinant, Epstein-Barr Virus, aa21-221, His-Tag
Artikelnummer: USB-586253
Hersteller Artikelnummer: 586253
Alternativnummer: USB-586253-20,USB-586253-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays diverse functions in immunomodulation and oncogenicity, maybe by acting as a functional receptor for human CSF1. May inhibit interferon secretion from mononuclear cells. Exhibits oncogenic activity in vitro. Source: Recombinant protein corresponding to aa21-221 from Epstein-Barr virus Secreted protein BARF1, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~28.4kD Amino Acid Sequence: VTAFLGERVTLTSYWRRVSLGPEIEVSWFKLGPGEEQVLIGRMHHDVIFIEWPFRGFFDIHRSANTFFLVVTAANISHDGNYLCRMKLGETEVTKQEHLSVVKPLTLSVHSERSQFPDFSVLTVTCTVNAFPHPHVQWLMPEGVEPAPTAANGGVMKEKDGSLSVAVDLSLPKPWHLPVTCVGKNDKEEAHGVYVSGYLSQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 28.4
UniProt: P0CW72
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.