Secretogranin-2, Recombinant, Human, aa418-617, His-GST-Tag

Artikelnummer: USB-586259
Artikelname: Secretogranin-2, Recombinant, Human, aa418-617, His-GST-Tag
Artikelnummer: USB-586259
Hersteller Artikelnummer: 586259
Alternativnummer: USB-586259-20, USB-586259-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Neuroendocrine protein of the granin family that regulates the biogenesis of secretory granules. Recombinant protein corresponding to aa418-617 from human Secretogranin-2, fused to 6X His-GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~54.3kD Amino Acid Sequence: TPGRAGTEALPDGLSVEDILNLLGMESAANQKTSYFPNPYNQEKVLPRLPYGAGRSRSNQLPKAAWIPHVENRQMAYENLNDKDQELGEYLARMLVKYPEIINSNQVKRVPGQGSSEDDLQEEEQIEQAIKEHLNQGSSQETDKLAPVSKRFPVGPPKNDDTPNRQYWDEDLLMKVLEYLNQEKAEKGREHIAKRAMENM Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 54.3
UniProt: P13521
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.