Secretogranin-3, Recombinant, Rat, aa23-471, His-Tag, Myc-Tag

Artikelnummer: USB-586260
Artikelname: Secretogranin-3, Recombinant, Rat, aa23-471, His-Tag, Myc-Tag
Artikelnummer: USB-586260
Hersteller Artikelnummer: 586260
Alternativnummer: USB-586260-20, USB-586260-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Member of the granin protein family that regulates the biogenesis of secretory granules. Acts as a sorting receptor for intragranular proteins including chromogranin A/CHGA. May also play a role in angiogenesis. Promotes endothelial proliferation, migration and tube formation through MEK/ERK signaling pathway. Source: Recombinant protein corresponding to aa23-471 from rat Secretogranin-3, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~58.2kD Amino Acid Sequence: FPKPEGSQDKSLHNRELSAERPLNEQIAEAEADKIKKTYPSESKPSESNFSSVDNLNLLKAITEKETVEKAKQSIRSSPFDNRLNVDDADSTKNRKLTDEYDSTKSGLDRKVQDDPDGLHQLDGTPLTAEDIVHKIATRIYEENDRGVFDKIVSKLLNLGLITESQAHTLEDEVAEALQKLISKEANNYEEAPEKPTSRTENQDGKIPEKVTPVAATQDGFTNRENDDTVSNTLTLSNGLERRTNPHRDDDFEELQYFPNFYALLTSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDETIALQTKNKLEKNTTDSKSKLFPAPPEKSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNLGGKTDEAKGKTEAYLEAIRKNIEWLKKHNKKGNKEDYDLSKMRDFINQQADAYVEKGILDKEEANAIKRIYSSL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 58.2
UniProt: P47868
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.