Serine-aspartate Repeat-containing Protein D, Recombinant, Staphylococcus aureus, aa36-330, His-Tag
Artikelnummer:
USB-586277
Hersteller Artikelnummer:
586277
Alternativnummer:
USB-586277-20,USB-586277-100
Hersteller:
US Biological
Kategorie:
Molekularbiologie
Cell surface-associated calcium-binding protein which plays an important role in adhesion and pathogenesis. Mediates interactions with components of the extracellular matrix such as host DSG1 to promote bacterial adhesion to host cells. Contributes to the resistance to killing by innate immune components such as neutrophils present in blood and thus attenuates bacterial clearance. Source: Recombinant protein corresponding to aa36-330 from Staphylococcus aureus Serine-aspartate repeat-containing protein D, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~38.0kD Amino Acid Sequence: LVGTTLIFGLGNQEAKAAESTNKELNEATTSASDNQSSDKVDMQQLNQEDNTKNDNQKEMVSSQGNETTSNGNKLIEKESVQSTTGNKVEVSTAKSDEQASPKSTNEDLNTKQTISNQEALQPDLQENKSVVNVQPTNEENKKVDAKTESTTLNVKSDAIKSNDETLVDNNSNSNNENNADIILPKSTAPKRLNTRMRIAAVQPSSTEAKNVNDLITSNTTLTVVDADKNNKIVPAQDYLSLKSQITVDDKVKSGDYFTIKYSDTVQVYGLNPEDIKNIGDIKDPNNGETIATAK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten