Serine/threonine-Protein Phosphatase 2A Catalytic Subunit beta Isoform, Recombinant, Human, aa1-309, GST-Tag

Artikelnummer: USB-586294
Artikelname: Serine/threonine-Protein Phosphatase 2A Catalytic Subunit beta Isoform, Recombinant, Human, aa1-309, GST-Tag
Artikelnummer: USB-586294
Hersteller Artikelnummer: 586294
Alternativnummer: USB-586294-20, USB-586294-100
Hersteller: US Biological
Kategorie: Molekularbiologie
PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase. Source: Recombinant protein corresponding to aa1-309 from human Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~62.6kD Amino Acid Sequence: MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 62.6
UniProt: P62714
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.