Serum Amyloid A Protein, Recombinant, Bovine, aa19-130, His-SUMO-Tag, Myc-Tag

Produktübersicht

• Artikelname: Serum Amyloid A Protein, Recombinant, Bovine, aa19-130, His-SUMO-Tag, Myc-Tag
• Artikelnummer: USB-586305
• Hersteller Artikelnummer: 586305
• Alternativnummer: USB-586305-20,USB-586305-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Major acute phase reactant. Apolipoprotein of the HDL complex. Source: Recombinant protein corresponding to aa19-130 from bovine Serum amyloid A protein, fused to 10X His-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~28.7kD Amino Acid Sequence: QWMSFFGEAYEGAKDMWRAYSDMREANYKGADKYFHARGNYDAAQRGPGGAWAAKVISDARENIQRFTDPLFKGTTSGQGQEDSRADQAANEWGRSGKDPNHFRPAGLPDKY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 28.7
• UniProt: P35541
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.