Serum Amyloid A Protein, Recombinant, Sheep, aa1-112, DEEP1-Tag

Artikelnummer: USB-586307
Artikelname: Serum Amyloid A Protein, Recombinant, Sheep, aa1-112, DEEP1-Tag
Artikelnummer: USB-586307
Hersteller Artikelnummer: 586307
Alternativnummer: USB-586307-20,USB-586307-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Major acute phase reactant. Apolipoprotein of the HDL complex. Source: Recombinant protein corresponding to aa1-112 from sheep Serum amyloid A protein, fused to DEEP1-Tag at C-terminal, expressed in Yeast. Molecular Weight: ~25.3kD Amino Acid Sequence: QWLSFLGEAYEGAKDMWRAYSDMREANFKGADKYFHARGNYDAAQRGPGGVWAAEVISNGREALQGITDPLFKGMTRDQVREDTKADQFANEWGRSGKDPNHFRPPGLPDKY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 25.3
UniProt: P42819
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.