Serum Amyloid A Protein, Recombinant, Sheep, aa1-112, His-Tag

Produktübersicht

• Artikelname: Serum Amyloid A Protein, Recombinant, Sheep, aa1-112, His-Tag
• Artikelnummer: USB-586308
• Hersteller Artikelnummer: 586308
• Alternativnummer: USB-586308-20,USB-586308-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Major acute phase reactant. Apolipoprotein of the HDL complex. Source: Recombinant protein corresponding to aa1-112 from sheep Serum amyloid A protein, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~18.7kD Amino Acid Sequence: QWLSFLGEAYEGAKDMWRAYSDMREANFKGADKYFHARGNYDAAQRGPGGVWAAEVISNGREALQGITDPLFKGMTRDQVREDTKADQFANEWGRSGKDPNHFRPPGLPDKY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 18.7
• UniProt: P42819
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.