Seryl-tRNA Synthetase, Cytoplasmic Domain Protein, Recombinant, Human, aa2-233, GST-Tag

Artikelnummer: USB-586312
Artikelname: Seryl-tRNA Synthetase, Cytoplasmic Domain Protein, Recombinant, Human, aa2-233, GST-Tag
Artikelnummer: USB-586312
Hersteller Artikelnummer: 586312
Alternativnummer: USB-586312-20, USB-586312-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Catalyzes the attachment of serine to tRNA(Ser) in a two-step reaction. Source: Recombinant protein corresponding to aa2-233 from human Seryl-tRNA synthetase,Cytoplasmic domain protein, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~53.4kD Amino Acid Sequence: VLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 53.4
UniProt: P49591
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.