Shiga Toxin Subunit B, Recombinant, Shigella dysenteriae serotype 1, aa21-89, His-Tag, Myc-Tag

Artikelnummer: USB-586319
Artikelname: Shiga Toxin Subunit B, Recombinant, Shigella dysenteriae serotype 1, aa21-89, His-Tag, Myc-Tag
Artikelnummer: USB-586319
Hersteller Artikelnummer: 586319
Alternativnummer: USB-586319-20, USB-586319-100
Hersteller: US Biological
Kategorie: Molekularbiologie
The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli. Source: Recombinant protein corresponding to aa21-89 from Shigella dysenteriae serotype 1 Shiga toxin subunit B, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~15.1kD Amino Acid Sequence: TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 15.1
UniProt: Q32GM0
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a liquid in Tris, 50% glycerol