Small Delta Antigen, Recombinant, Hepatitis Delta Virus Genotype I, aa1-195, His-Tag, Myc-Tag

Artikelnummer: USB-586358
Artikelname: Small Delta Antigen, Recombinant, Hepatitis Delta Virus Genotype I, aa1-195, His-Tag, Myc-Tag
Artikelnummer: USB-586358
Hersteller Artikelnummer: 586358
Alternativnummer: USB-586358-20,USB-586358-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Promotes both transcription and replication of genomic RNA. Following virus entry into host cell, provides nuclear import of HDV RNPs thanks to its nuclear localization signal. May interact with host RNA polymerase II thereby changing its template requirement from DNA to RNA. RNA pol II complex would then acts as an RNA-directed RNA polymerase, and transcribe and replicate HDV genome. Source: Recombinant protein corresponding to aa1-195 from Hepatitis delta virus genotype I Small delta antigen, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~29.3kD Amino Acid Sequence: MSRSESRKNRGGREEILEQWVAGRKKLEELERDLRKTKKKLKKIEDENPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPLRGGFTDKERQDHRRRKALENKKKQLSAGGKNLSKEEEEELRRLTEEDERRERRVAGPPVGGVIPLEGGSRGAPGGGFVPSLQGVPESPFSRTGEGLDIRGNRGFP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 29.3
UniProt: P06934
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.