Small Heat Shock Protein ibpA, Recombinant, Yersinia pestis bv. Antiqua, aa1-137, His-Tag
Artikelnummer:
USB-586359
Hersteller Artikelnummer:
586359
Alternativnummer:
USB-586359-20,USB-586359-100
Hersteller:
US Biological
Kategorie:
Molekularbiologie
Associates with aggregated proteins, together with IbpB, to stabilize and protect them from irreversible denaturation and extensive proteolysis during heat shock and oxidative stress. Aggregated proteins bound to the IbpAB complex are more efficiently refolded and reactivated by the ATP-dependent chaperone systems ClpB and DnaK/DnaJ/GrpE. Its activity is ATP-independent. Source: Recombinant protein corresponding to aa1-137 from Yersinia pestis bv. Antiqua Small heat shock protein ibpA, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~21.6kD Amino Acid Sequence: MRNSDLAPLYRSAIGFDRLFNLLESGQNQSNGGYPPYNVELVDENNYRIAIAVAGFAEQELEITTQDNLLIVRGSHANEPAQRTYLYQGIAERNFERKFQLAEHIKIKGANLVNGLLYIDLERLVPESLKPRRIEIK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten