Snake Venom Metalloproteinase-disintegrin-like Mocarhagin, Recombinant, Naja mossambica, aa192-609, His-Tag

Artikelnummer: USB-586367
Artikelname: Snake Venom Metalloproteinase-disintegrin-like Mocarhagin, Recombinant, Naja mossambica, aa192-609, His-Tag
Artikelnummer: USB-586367
Hersteller Artikelnummer: 586367
Alternativnummer: USB-586367-20, USB-586367-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Snake venom zinc metalloproteinase that inhibits platelet aggregation by cleaving platelet glycoprotein Ib alpha (GP1BA) at Glu-298/Asp-299, and abolishes binding of von Willebrand factor (VWF) to GPIBA. Cleaves P-selectin glycoprotein ligand-1 (PSGL-1/SELPLG) at Tyr-51/Asp-52, and completely abolishes the binding of PSGL-1 to P-selectin. Anionic amino acid sequences containing sulfated tyrosines are needed for cleavages. Inhibits the thrombin-induced platelet aggregation, and the thrombin-induced release of ATP and ADP. Has lectin activity (inhibited by heparin). Source: Recombinant protein corresponding to aa192-609 from Naja mossambica Snake venom metalloproteinase-disintegrin-like mocarhagin, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~50.7kD Amino Acid Sequence: TNTPEQDRYLQAKKYIEFYVVVDNVMYRKYTGKLHVITRRVYEMVNALNTMYRRLNFHIALIGLEIWSNGNEINVQSDVQATLDLFGEWRENKLLPRKRNDNAQLLTSTEFNGTTTGLGYIGSLCSPKKSVAVVQDHSKSTSMVAITMAHQMGHNLGMNDDRASCTCGSNKCIMSTKYYESLSEFSSCSVQEHREYLLRDRPQCILNKPSRKAIVTPPVCGNYFVERGEECDCGSPEDCQNTCCDAATCKLQHEAQCDSGECCEKCKFKGAGAECRAAKNDCDFPELCTGRSAKCPKDSFQRNGHPCQNNQGYCYNGTCPTLTNQCATLWGPGAKMSPGLCFMLNWNARSCGLCRKENGRKILCAAKDVKCGRLFCKKKNSMICHCPPPSKDPNYGMVAPGTKCGVKKVCRNRQCVKV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 50.7
UniProt: Q10749
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.