Sperm Surface Protein Sp17, Recombinant, Human, aa1-146, GST-Tag

Produktübersicht

• Artikelname: Sperm Surface Protein Sp17, Recombinant, Human, aa1-146, GST-Tag
• Artikelnummer: USB-586387
• Hersteller Artikelnummer: 586387
• Alternativnummer: USB-586387-20,USB-586387-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Sperm surface zona pellucida binding protein. Helps to bind spermatozoa to the zona pellucida with high affinity. Might function in binding zona pellucida and carbohydrates. Source: Recombinant protein corresponding to aa1-146 from human Sperm surface protein Sp17, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~43.8kD Amino Acid Sequence: MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 43.8
• UniProt: Q15506
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.