Staphylococcal Complement Inhibitor, Recombinant, Staphylococcus aureus, aa32-116, His-Tag

Artikelnummer: USB-586403
Artikelname: Staphylococcal Complement Inhibitor, Recombinant, Staphylococcus aureus, aa32-116, His-Tag
Artikelnummer: USB-586403
Hersteller Artikelnummer: 586403
Alternativnummer: USB-586403-20
Hersteller: US Biological
Kategorie: Molekularbiologie
Involved in countering the first line of host defense mechanisms. Efficiently inhibits opsonization, phagocytosis and killing of S.aureus by human neutrophils. Acts by binding and stabilizing human C3 convertases (C4b2a and C3bBb), leading to their inactivation. The convertases are no longer able to cleave complement C3, therefore preventing further C3b deposition on the bacterial surface and phagocytosis of the bacterium. Also prevents C5a-induced neutrophil responses. Source: Recombinant protein corresponding to aa32-116 from Staphylococcus aureus Staphylococcal complement inhibitor, fused to 10X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~12.3kD Amino Acid Sequence: STSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGLKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 12.3
UniProt: Q99SU9
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.