Syndecan-4, Recombinant, Human, aa19-145, His-SUMO-Tag

Artikelnummer: USB-586445
Artikelname: Syndecan-4, Recombinant, Human, aa19-145, His-SUMO-Tag
Artikelnummer: USB-586445
Hersteller Artikelnummer: 586445
Alternativnummer: USB-586445-20,USB-586445-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Cell surface proteoglycan that bears heparan sulfate. Regulates exosome biogenesis in concert with SDCBP and PDCD6IP. Source: Recombinant protein corresponding to aa19-145 from human Syndecan-4, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~29.9kD Amino Acid Sequence: ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 29.9
UniProt: P31431
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.