Tau-theraphotoxin-Hs1a, Recombinant, Cyriopagopus schmidti, aa1-79, His-Tag

Artikelnummer: USB-586463
Artikelname: Tau-theraphotoxin-Hs1a, Recombinant, Cyriopagopus schmidti, aa1-79, His-Tag
Artikelnummer: USB-586463
Hersteller Artikelnummer: 586463
Alternativnummer: USB-586463-20, USB-586463-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Selectively activates the heat-activated TRPV1 channel. It binds to TRPV1 in an open state-dependent manner, trapping it there to produce irreversible currents. Source: Recombinant protein corresponding to aa1-79 from Cyriopagopus schmidti Tau-theraphotoxin-Hs1a, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~13.1kD Amino Acid Sequence: DCAKEGEVCSWGKKCCDLDNFYCPMEFIPHCKKYKPYVPVTTNCAKEGEVCGWGSKCCHGLDCPLAFIPYCEKYRGRND Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 13.1
UniProt: P0CH43
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.