Tetracycline Resistance Protein tetM, Recombinant, Staphylococcus aureus, aa1-242, His-Tag, Myc-Tag

Artikelnummer: USB-586478
Artikelname: Tetracycline Resistance Protein tetM, Recombinant, Staphylococcus aureus, aa1-242, His-Tag, Myc-Tag
Artikelnummer: USB-586478
Hersteller Artikelnummer: 586478
Alternativnummer: USB-586478-20,USB-586478-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Abolishes the inhibitory effect of tetracyclin on protein synthesis by a non-covalent modification of the ribosomes. Source: Recombinant protein corresponding to aa1-242 from Staphylococcus aureus Tetracycline resistance protein tetM, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~32.1kD Amino Acid Sequence: MKIINIGVLAHVDAGKTTLTESLLYNSGAITELGSVDKGTTRTDNTLLERQRGITIQTGITSFQWENTKVNIIDTPGHMDFLAEVYRSLSVLDGAILLISAKDFVQAQTRILFHALRKMGIPTIFFINKIDQNGIDLSTVYQDIKEKLSAEIVIKQKVELYPNMCVTNFTESEQWDTVIEGNDDLLEKYMSGKSLEALELEQEESIRFQNCSLFPLYHGSAKSNIGIDNLIEVITNKFYSST Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 32.1
UniProt: Q53770
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.