Thioredoxin-1, Recombinant, E. coli, aa2-109, His-Tag

Artikelnummer: USB-586487
Artikelname: Thioredoxin-1, Recombinant, E. coli, aa2-109, His-Tag
Artikelnummer: USB-586487
Hersteller Artikelnummer: 586487
Alternativnummer: USB-586487-20,USB-586487-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Source: Recombinant protein corresponding to aa2-109 from Escherichia coli Thioredoxin-1, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~15.7kD Amino Acid Sequence: SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 15.7
UniProt: P0AA25
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.