Thiosulfate-binding Protein, Recombinant, E. coli, aa26-338, His-SUMO-Tag

Artikelnummer: USB-586494
Artikelname: Thiosulfate-binding Protein, Recombinant, E. coli, aa26-338, His-SUMO-Tag
Artikelnummer: USB-586494
Hersteller Artikelnummer: 586494
Alternativnummer: USB-586494-20, USB-586494-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Part of the ABC transporter complex CysAWTP (TC 3.A.1.6.1) involved in sulfate/thiosulfate import. This protein specifically binds thiosulfate and is involved in its transmembrane transport. Source: Recombinant protein corresponding to aa26-338 from Escherichia coli Thiosulfate-binding protein, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~48.0kD Amino Acid Sequence: TELLNSSYDVSRELFAALNPPFEQQWAKDNGGDKLTIKQSHAGSSKQALAILQGLKADVVTYNQVTDVQILHDKGKLIPADWQSRLPNNSSPFYSTMGFLVRKGNPKNIHDWNDLVRSDVKLIFPNPKTSGNARYTYLAAWGAADKADGGDKGKTEQFMTQFLKNVEVFDTGGRGATTTFAERGLGDVLISFESEVNNIRKQYEAQGFEVVIPKTNILAEFPVAWVDKNVQANGTEKAAKAYLNWLYSPQAQTIITDYYYRVNNPEVMDKLKDKFPQTELFRVEDKFGSWPEVMKTHFTSGGELDKLLAAGRN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 48
UniProt: P16700
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.