Thrombin-like Enzyme Flavoxobin, Recombinant, Protobothrops flavoviridis, aa25-260, His-Tag, Myc-Tag

Artikelnummer: USB-586500
Artikelname: Thrombin-like Enzyme Flavoxobin, Recombinant, Protobothrops flavoviridis, aa25-260, His-Tag, Myc-Tag
Artikelnummer: USB-586500
Hersteller Artikelnummer: 586500
Alternativnummer: USB-586500-20, USB-586500-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Thrombin-like snake venom serine protease that clots fibrinogen (FGA) by releasing fibrinopeptide A. According to PubMed:8585090, only cleaves rabbit fibrinogen, whereas no specificity is described in PubMed:3910643 (tests done on bovine fibrinogen). Also acts as a C3 convertase that independently cleaves human C3 and kick-starts the complement cascade. Also increases urokinase-type plasminogen activator (PLAU) and plasminogen activator inhibitor (SERPINE1) in cultured bovine pulmonary artery endothelial cells. Dose-dependently inhibits collagen-induced platelet aggregation. Source: Recombinant protein corresponding to aa25-260 from Protobothrops flavoviridis Thrombin-like enzyme flavoxobin, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~33.1kD Amino Acid Sequence: VIGGDECNINEHPFLVALYDAWSGRFLCGGTLINPEWVLTAAHCDSKNFKMKLGAHSKKVLNEDEQIRNPKEKFICPNKKNDEVLDKDIMLIKLDSPVSYSEHIAPLSLPSSPPSVGSVCRIMGWGSITPVEETFPDVPHCANINLLDDVECKPGYPELLPEYRTLCAGVLQGGIDTCGFDSGTPLICNGQFQGIVSYGGHPCGQSRKPGIYTKVFDYNAWIQSIIAGNTAATCLP Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 33.1
UniProt: P05620
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a liquid in Tris, 50% glycerol