Thymosin Beta-10, Recombinant, Mouse, aa2-44, His-SUMO-Tag

Artikelnummer: USB-586508
Artikelname: Thymosin Beta-10, Recombinant, Mouse, aa2-44, His-SUMO-Tag
Artikelnummer: USB-586508
Hersteller Artikelnummer: 586508
Alternativnummer: USB-586508-20,USB-586508-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization. Source: Recombinant protein corresponding to aa2-44 from mouse Thymosin beta-10, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~17.8kD Amino Acid Sequence: ADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 17.8
UniProt: Q6ZWY8
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.