Tissue Factor Pathway Inhibitor, Recombinant, Rabbit, aa25-300, His-Tag

Artikelnummer: USB-586519
Artikelname: Tissue Factor Pathway Inhibitor, Recombinant, Rabbit, aa25-300, His-Tag
Artikelnummer: USB-586519
Hersteller Artikelnummer: 586519
Alternativnummer: USB-586519-20, USB-586519-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma. Source: Recombinant protein corresponding to aa25-300 from rabbit Tissue factor pathway inhibitor, fused to 10X His-Tag at N-terminal, expressed in Mammalian cell. Molecular Weight: ~35.4kD Amino Acid Sequence: AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 35.4
UniProt: P19761
Reinheit: 95% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.