Toxin Tb2-II, Recombinant, Tityus Bahiensis, aa1-62, His-Tag, Myc-Tag

Artikelnummer: USB-586535
Artikelname: Toxin Tb2-II, Recombinant, Tityus Bahiensis, aa1-62, His-Tag, Myc-Tag
Artikelnummer: USB-586535
Hersteller Artikelnummer: 586535
Alternativnummer: USB-586535-20
Hersteller: US Biological
Kategorie: Molekularbiologie
Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing (By similarity). This toxin is active against both mammals and insects. Source: Recombinant protein corresponding to aa1-62 from Tityus bahiensis Toxin Tb2-II, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~10.8kD Amino Acid Sequence: KEGYAMDHEGCKFSCFIRPSGFCDGYCKTHLKASSGYCAWPACYCYGVPSNIKVWDYATNKC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 10.8
UniProt: P60276
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.