TPR Repeat-containing Thioredoxin TDX, Recombinant, Oryza sativa subsp. japonica, aa1-317, His-Tag, Myc-Tag

Artikelnummer: USB-586538
Artikelname: TPR Repeat-containing Thioredoxin TDX, Recombinant, Oryza sativa subsp. japonica, aa1-317, His-Tag, Myc-Tag
Artikelnummer: USB-586538
Hersteller Artikelnummer: 586538
Alternativnummer: USB-586538-20,USB-586538-200
Hersteller: US Biological
Kategorie: Molekularbiologie
Probable thiol-disulfide oxidoreductase that may participate in various redox reactions and act as chaperone under heat shock. May interact with HSP70 proteins through the TPR repeats. Source: Recombinant protein corresponding to aa1-317 from Oryza sativa subsp. japonica TPR repeat-containing thioredoxin TDX, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~42.0kD Amino Acid Sequence: MATAGASSFEDEIMESDIELEGEAVEPDNDPPQKMGDPSVEVSDEKRDQAQLCKNKGVDAFSEGKLDEAIEHLTEAIVLNPTSAIAYATRAVIFVKSKKPNAAIRDADAALKINPDSAKGYKSRGMAKAMLGKWEEAAQDLRMAAKLDYDEEIGAELKKVEPNVLKIEEHRKKYERLRKERDIKKAEMEKQRKHAEEVSAASAALKDGDVIAIHSSSELDTKLKAASSLSRLVVLYFTAAWCGPCRFIGPVCKSLAEKHRNVVFLKVDIDELNSVAYRWNVSSVPSFFFVRNGKEIDKVVGADKNGLERKVAQHGSS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 42
UniProt: Q6ES52
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.