Trans-activator Protein BZLF1, Recombinant, Epstein-Barr virus, aa1-245, His-Tag, Myc-Tag

Produktübersicht

• Artikelname: Trans-activator Protein BZLF1, Recombinant, Epstein-Barr virus, aa1-245, His-Tag, Myc-Tag
• Artikelnummer: USB-586539
• Hersteller Artikelnummer: 586539
• Alternativnummer: USB-586539-20,USB-586539-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Plays a key role in the switch from latent infection to lytic cycle producing new virions. Acts as a transcription factor, inducing early lytic cycle genes, and as a origin binding protein for genome replication. BZLF1 activates the promoter of another EBV gene (BSLF2+BMLF1). Source: Recombinant protein corresponding to aa1-245 from Epstein-Barr virus Trans-activator protein BZLF1, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~33.8kD Amino Acid Sequence: MMDPNSTSEDVKFTPDPYQVPFVQAFDQATRVYQDLGGPSQAPLPCVLWPVLPEPLPQGQLTAYHVSAAPTGSWFPAPQPAPENAYQAYAAPQLFPVSDITQNQLTNQAGGEAPQPGDNSTVQPAAAVVLACPGANQEQQLADIGAPQPAPAAAPARRTRKPLQPESLEECDSELEIKRYKNRVASRKCRAKFKHLLQHYREVASAKSSENDRLRLLLKQMCPSLDVDSIIPRTPDVLHEDLLNF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 33.8
• UniProt: Q3KSS8
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.