Transforming Growth Factor Beta-2, Recombinant, Human, aa304-413, His-Tag

Artikelnummer: USB-586575
Artikelname: Transforming Growth Factor Beta-2, Recombinant, Human, aa304-413, His-Tag
Artikelnummer: USB-586575
Hersteller Artikelnummer: 586575
Alternativnummer: USB-586575-20, USB-586575-100
Hersteller: US Biological
Kategorie: Molekularbiologie
TGF-beta 2 has suppressive effects on interleukin-2 dependent T-cell growth. Source: Recombinant protein corresponding to aa304-413 from human Transforming growth factor beta-2, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~16.7kD Amino Acid Sequence: LDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 16.7
UniProt: P61812
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.