Transient Receptor Potential Cation Channel Subfamily A Member 1, Recombinant, Human, aa957-1119, His-SUMO-Tag
Artikelnummer:
USB-586578
Hersteller Artikelnummer:
586578
Alternativnummer:
USB-586578-20,USB-586578-100
Hersteller:
US Biological
Kategorie:
Molekularbiologie
Receptor-activated non-selective cation channel involved in detection of pain and possibly also in cold perception and inner ear function. Source: Recombinant protein corresponding to aa957-1119 from human Transient receptor potential cation channel subfamily A member 1, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~35.2kD Amino Acid Sequence: IGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIFCFLFCTGEIRQEIPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten