Transitional Endoplasmic Reticulum ATPase, Putative, Recombinant, Leishmania donovani, aa15-98, His-Tag

Artikelnummer: USB-586579
Artikelname: Transitional Endoplasmic Reticulum ATPase, Putative, Recombinant, Leishmania donovani, aa15-98, His-Tag
Artikelnummer: USB-586579
Hersteller Artikelnummer: 586579
Alternativnummer: USB-586579-20,USB-586579-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa15-98 from Leishmania donovani Transitional endoplasmic reticulum ATPase, putative, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~13.7kD Amino Acid Sequence: NKLIVEEPYNDDNSVVSLNPKRMEELNIFRGDTVLVKGKKHRSTVCIAMEDDECPPEKIKMNKVARRNIRIHLGDTIRIAPCKD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 13.7
UniProt: E9BTK1
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.