Transposase InsE For Insertion Sequence IS3A, Recombinant, E. coli, aa1-99, His-Tag

Artikelnummer: USB-586594
Artikelname: Transposase InsE For Insertion Sequence IS3A, Recombinant, E. coli, aa1-99, His-Tag
Artikelnummer: USB-586594
Hersteller Artikelnummer: 586594
Alternativnummer: USB-586594-20,USB-586594-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Involved in the transposition of the insertion sequence IS3. Source: Recombinant protein corresponding to aa1-99 from Escherichia coli Transposase insE for insertion sequence IS3A, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~15.6kD Amino Acid Sequence: MTKTVSTSKKPRKQHSPEFRSEALKLAERIGVTAAARELSLYESQLYNWRSKQQNQQTSSERELEMSTEIARLKRQLAERDEELAILQKAATYFAKRLK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 15.6
UniProt: P0CF66
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.