Truncated Plaque-size/host Range Protein, Recombinant, Vaccinia virus, aa18-92, His-Tag

Artikelnummer: USB-586638
Artikelname: Truncated Plaque-size/host Range Protein, Recombinant, Vaccinia virus, aa18-92, His-Tag
Artikelnummer: USB-586638
Hersteller Artikelnummer: 586638
Alternativnummer: USB-586638-20,USB-586638-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Regulation of plaque size and host range. In this strain the truncated ps/hr protein is probably not functional. Recombinant protein corresponding to aa18-92 from Vaccinia virus Truncated plaque-size/host range protein, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~10.6kD Amino Acid Sequence: YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 10.6
UniProt: P24284
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.