Trypsin-3, Recombinant, Human, aa81-303, His-Tag

Artikelnummer: USB-586643
Artikelname: Trypsin-3, Recombinant, Human, aa81-303, His-Tag
Artikelnummer: USB-586643
Hersteller Artikelnummer: 586643
Alternativnummer: USB-586643-20,USB-586643-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Digestive protease that cleaves proteins preferentially after an Arg residue and has proteolytic activity toward Kunitz-type trypsin inhibitors. Source: Recombinant protein corresponding to aa81-303 from human Trypsin-3, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~28.2kD Amino Acid Sequence: IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAAN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 28.2
UniProt: P35030
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.