Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production. Source: Partial recombinant protein corresponding to aa45-187 from rabbit Tumor necrosis factor ligand superfamily member 4, fused to hFc-Tag at C-terminal, expressed in Mammalian cell. Unprot/Accession: O02765 Molecular Weight: ~44.9kD Amino Acid Sequence: QHSHAPEVSLQYPPIENIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSISLHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQNPGGYCAP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
