Tumor Necrosis Factor Receptor Superfamily Member 25, Recombinant, Human, aa25-199, His-Tag

Artikelnummer: USB-586669
Artikelname: Tumor Necrosis Factor Receptor Superfamily Member 25, Recombinant, Human, aa25-199, His-Tag
Artikelnummer: USB-586669
Hersteller Artikelnummer: 586669
Alternativnummer: USB-586669-20, USB-586669-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Receptor for TNFSF12/APO3L/TWEAK. Interacts directly with the adapter TRADD. Mediates activation of NF-kappa-B and induces apoptosis. May play a role in regulating lymphocyte homeostasis. Source: Recombinant protein corresponding to aa25-199 from human Tumor necrosis factor receptor superfamily member 25, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~22.9kD Amino Acid Sequence: QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 22.9
UniProt: Q93038
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.