Type III Secretion System Needle Protein, Recombinant, Burkholderia thailandensis, aa1-89, His-Tag

Artikelnummer: USB-586681
Artikelname: Type III Secretion System Needle Protein, Recombinant, Burkholderia thailandensis, aa1-89, His-Tag
Artikelnummer: USB-586681
Hersteller Artikelnummer: 586681
Alternativnummer: USB-586681-20, USB-586681-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa1-89 from Burkholderia thailandensis Type III secretion system needle protein, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~11.9kD Amino Acid Sequence: MSNPPTPLLTDYEWSGYLTGIGRAFDTGVKDLNQQLQDAQANLTKNPSDPTALANYQMIMSEYNLYRNAQSSAVKSMKDIDSSIVSNFR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 11.9
UniProt: Q2T727
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.