Type III Secretion System Needle Protein, Recombinant, Burkholderia thailandensis, aa1-89, His-Tag

Produktübersicht

• Artikelname: Type III Secretion System Needle Protein, Recombinant, Burkholderia thailandensis, aa1-89, His-Tag
• Artikelnummer: USB-586681
• Hersteller Artikelnummer: 586681
• Alternativnummer: USB-586681-20,USB-586681-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa1-89 from Burkholderia thailandensis Type III secretion system needle protein, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~11.9kD Amino Acid Sequence: MSNPPTPLLTDYEWSGYLTGIGRAFDTGVKDLNQQLQDAQANLTKNPSDPTALANYQMIMSEYNLYRNAQSSAVKSMKDIDSSIVSNFR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 11.9
• UniProt: Q2T727
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.