Type-2 Angiotensin II Receptor, Recombinant, Human, aa1-45, His-SUMO-Tag

Produktübersicht

• Artikelname: Type-2 Angiotensin II Receptor, Recombinant, Human, aa1-45, His-SUMO-Tag
• Artikelnummer: USB-586682
• Hersteller Artikelnummer: 586682
• Alternativnummer: USB-586682-20,USB-586682-100,USB-586682-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Receptor for angiotensin II. Cooperates with MTUS1 to inhibit ERK2 activation and cell proliferation. Source: Recombinant protein corresponding to aa1-45 from human Type-2 angiotensin II receptor, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~20.8kD Amino Acid Sequence: MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 20.8
• UniProt: P50052
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.