Uncharacterized Protein C1orf54, Recombinant, Human, aa17-131, His-B2M-Tag

Produktübersicht

• Artikelname: Uncharacterized Protein C1orf54, Recombinant, Human, aa17-131, His-B2M-Tag
• Artikelnummer: USB-586721
• Hersteller Artikelnummer: 586721
• Alternativnummer: USB-586721-20,USB-586721-100,USB-586721-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa17-131 from human Uncharacterized protein C1orf54, fused to 6X His-B2M-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~27.2kD Amino Acid Sequence: QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 27.2
• UniProt: Q8WWF1
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.