WNT1-Inducible-signaling Pathway Protein 2, Recombinant, Human, aa1-250, GST-Tag

Produktübersicht

• Artikelname: WNT1-Inducible-signaling Pathway Protein 2, Recombinant, Human, aa1-250, GST-Tag
• Artikelnummer: USB-586804
• Hersteller Artikelnummer: 586804
• Alternativnummer: USB-586804-20,USB-586804-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production. Source: Recombinant protein corresponding to aa1-250 from human WNT1-inducible-signaling pathway protein 2, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~51.3kD Amino Acid Sequence: MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 51.3
• UniProt: O76076
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.