Beta-nerve Growth Factor, Active, Recombinant, Human, aa122-241 (NGF)

Artikelnummer: USB-586842
Artikelname: Beta-nerve Growth Factor, Active, Recombinant, Human, aa122-241 (NGF)
Artikelnummer: USB-586842
Hersteller Artikelnummer: 586842
Alternativnummer: USB-586842-10,USB-586842-50
Hersteller: US Biological
Kategorie: Molekularbiologie
Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI Recombinant protein corresponding to aa122-241 from human Beta-nerve growth factor, expressed in E.coli. Molecular Weight: ~13.4kD Biological Activity: The ED50 as determined in a cell proliferation assay using TF?1 human erythroleukemic cells is less than 2ng/ml. Amino Acid Sequence: SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 13.4
UniProt: P01138
Reinheit: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Formulierung: Supplied as a lyophilized powder from 20mM PBS, pH 7.4. Reconstitute with sterile ddH2O, to a concentration of 0.1-1mg/ml.