E. Coli Iron-sulfur Cluster Repair Protein ytfE, Active, Recombinant, Human, GST-Tag, aa1-220 (ytfE)

Artikelnummer: USB-586867
Artikelname: E. Coli Iron-sulfur Cluster Repair Protein ytfE, Active, Recombinant, Human, GST-Tag, aa1-220 (ytfE)
Artikelnummer: USB-586867
Hersteller Artikelnummer: 586867
Alternativnummer: USB-586867-20,USB-586867-100,USB-586867-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Di-iron-containing protein involved in the repair of iron-sulfur clusters damaged by oxidative and nitrosative stress conditions. Recombinant protein corresponding to aa1-220 from Basic leucine zipper and W2 domain-containing protein 2, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~51.9kD Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized aqpZ at 5µg/ml can bind human ytfE, the EC50 of human ytfE protein is 197.90-259.70ug/ml. Amino Acid Sequence: MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAEQPIEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYLTMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTPPPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molekulargewicht: 51.9
UniProt: P69506
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from Tris-HCl, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O, 0.1% BSA to a concentration of 0.1-1mg/ml.