Fibroblast growth factor 17, Active, Recombinant, Human, His-Tag, aa23-216 (FGF17)

Artikelnummer: USB-586884
Artikelname: Fibroblast growth factor 17, Active, Recombinant, Human, His-Tag, aa23-216 (FGF17)
Artikelnummer: USB-586884
Hersteller Artikelnummer: 586884
Alternativnummer: USB-586884-10, USB-586884-50
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. Required for normal brain development. Recombinant protein corresponding to aa23-216 from human Fibroblast growth factor 17, fused to 6X His-Tag at C-terminal, expressed in Mammalian cell. Accession/Uniprot: O60258 Molecular Weight: ~22.64kD Biological Activity: The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is less than 15ug/ml. Amino Acid Sequence: TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 22.64
UniProt: O60258
Reinheit: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Formulierung: Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with sterile ddH2O, to a concentration of 0.1-1mg/ml.