Fibroblast Growth Factor 2, Active, Recombinant, Mouse, aa1-154 (Fgf2)

Artikelnummer: USB-586889
Artikelname: Fibroblast Growth Factor 2, Active, Recombinant, Mouse, aa1-154 (Fgf2)
Artikelnummer: USB-586889
Hersteller Artikelnummer: 586889
Alternativnummer: USB-586889-10, USB-586889-50
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal limb and cardiac valve development during embryogenesis. Recombinant protein corresponding to aa1-154 from mouse Fibroblast growth factor 2, expressed in E.coli. Molecular Weight: ~17.15kD Biological Activity: The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 2ng/ml. Amino Acid Sequence: MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 17.15
UniProt: P15655
Reinheit: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Formulierung: Supplied as a lyophilized powder from 20mM PBS, pH 7.0. Reconstitute with sterile ddH2O, to a concentration of 0.1-1mg/ml.