Fibroblast Growth Factor 4, Active, Recombinant, Human, aa54-206 (FGF4)

Artikelnummer: USB-586891
Artikelname: Fibroblast Growth Factor 4, Active, Recombinant, Human, aa54-206 (FGF4)
Artikelnummer: USB-586891
Hersteller Artikelnummer: 586891
Alternativnummer: USB-586891-10, USB-586891-50
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal limb and cardiac valve development during embryogenesis. Partial Recombinant protein corresponding to aa54-206 from human Fibroblast growth factor 4, expressed in E.coli. Molecular Weight: ~16.9kD Biological Activity: The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 10ng/ml. Amino Acid Sequence: SLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 16.9
UniProt: P08620
Reinheit: 95% (SDS-PAGE) Endotoxin: 1EU/ug (LAL)
Formulierung: Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with sterile ddH2O, to a concentration of 0.1-1mg/ml.